PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_22909
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family ERF
Protein Properties Length: 105aa    MW: 11240 Da    PI: 4.2076
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_22909genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP248.91.6e-153441255
         AP2 12 rgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
                +g++vAeIrd s++g   r +lg+f+taeeAa+a+++a+ +l+g
  PEQU_22909  3 WGKFVAEIRD-STRG-GVRLWLGTFDTAEEAARAYDRAAAALRG 44
                9*********.3433.4*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103218.373152IPR001471AP2/ERF domain
SuperFamilySSF541711.44E-18253IPR016177DNA-binding domain
SMARTSM003809.1E-24258IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.105.1E-24352IPR001471AP2/ERF domain
PfamPF008471.5E-9344IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
XXWGKFVAEI RDSTRGGVRL WLGTFDTAEE AARAYDRAAA ALRGQLAILN FPGEVPISAT  60
TGITTSTATG SSETASRPEA GRGEQVIELE CLDDKLLEDL LYVGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gcc_A1e-183551163ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1
2gcc_A1e-183551466ATERF1
3gcc_A1e-183551466ATERF1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010039174.12e-33PREDICTED: ethylene-responsive transcription factor ERF096-like
SwissprotQ9LTC58e-29ERF98_ARATH; Ethylene-responsive transcription factor ERF098
TrEMBLA0A059D1V23e-33A0A059D1V2_EUCGR; Uncharacterized protein
STRINGGSMUA_Achr1P15350_0017e-31(Musa acuminata)
STRINGGSMUA_Achr4P12070_0011e-30(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27737249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23230.16e-16ERF family protein